Iright
BRAND / VENDOR: Proteintech

Proteintech, 10345-1-AP, RNH1 Polyclonal antibody

CATALOG NUMBER: 10345-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNH1 (10345-1-AP) by Proteintech is a Polyclonal antibody targeting RNH1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10345-1-AP targets RNH1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, human brain tissue, human heart tissue, human liver tissue, L02 cells, HepG2 cells, Jurkat cells, human placenta tissue, NIH/3T3 cells, rat liver tissue Positive IP detected in: HEK-293T cells, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse liver tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, A431 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Ribonuclease/ angiogenin inhibitor (RNH, synonyms: RAI, MGC4569, MGC18200, MGC54054) is a protein that binds tightly to ribonucleases in cells and may be essential in the control of mRNA degradation and gene expression. The human RNH gene has been regionally localized to chromosome band 11p15 by in situ hybridization. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0350 Product name: Recombinant human RNH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC000677 Sequence: MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVHVLCQGLKDSPCQLEALKLESCGVTSD Predict reactive species Full Name: ribonuclease/angiogenin inhibitor 1 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC000677 Gene Symbol: RNH1 Gene ID (NCBI): 6050 RRID: AB_2269733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924