Iright
BRAND / VENDOR: Proteintech

Proteintech, 10346-1-AP, CTBP2 Polyclonal antibody

CATALOG NUMBER: 10346-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTBP2 (10346-1-AP) by Proteintech is a Polyclonal antibody targeting CTBP2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10346-1-AP targets CTBP2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, rat brain tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human pancreas cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information C-Terminal binding protein 2 (CTBP2) is a transcriptional repressor. It contains a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. This protein is thought to bind to the C-terminus of the adenovirus E1A proteins. Studies in mice suggested that this protein is involved in transcriptional repression. CTBP2 is expressed in all tissues tested, with a higher level of expression in the heart, skeletal muscle, and pancreas. The gene of CTBP2 is mapped to human chromosome 21q21.3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, zebrafish, gerbil Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0352 Product name: Recombinant human CTBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-201 aa of BC002486 Sequence: QIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKA Predict reactive species Full Name: C-terminal binding protein 2 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC002486 Gene Symbol: CTBP2 Gene ID (NCBI): 1488 RRID: AB_2261202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56545 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924