Iright
BRAND / VENDOR: Proteintech

Proteintech, 10353-1-AP, PDE6B Polyclonal antibody

CATALOG NUMBER: 10353-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDE6B (10353-1-AP) by Proteintech is a Polyclonal antibody targeting PDE6B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10353-1-AP targets PDE6B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information PDE6 is a cGMP-specific PDE family and presents multicomponent enzyme complexes. The rod PDE6 enzyme is comprised of two catalytic subunits (PDE6A and PDE6B) and it is expressed in human lungs(PMID:20979602). PDE6B(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta) is also named as PDEB and belongs to the cyclic nucleotide phosphodiesterase family. PDE6B also has a C-terminal CAAX motif for posttranslational processing involving lipidation, proteolysis, and carboxymethylation (PMID:8394243). Defects in PDE6B are the cause of retinitis pigmentosa type 40 (RP40)(PMID:22334370) and congenital stationary night blindness autosomal dominant type 2 (CSNBAD2)(PMID:8075643). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0365 Product name: Recombinant human PDE6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-428 aa of BC000249 Sequence: GPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLTQFLGWS Predict reactive species Full Name: phosphodiesterase 6B, cGMP-specific, rod, beta Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC000249 Gene Symbol: PDE6B Gene ID (NCBI): 5158 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924