Proteintech, 10358-1-AP, DDX50 Polyclonal antibody

Size: 20ul / 150ul The DDX50 (10358-1-AP) by Proteintech is a Polyclonal antibody targeting DDX50 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 10358-1-AP targets DDX50 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DEAD box polypeptide 50 (DDX50, synonyms: GU2, GUB, MGC3199, RH-II/GuB) enzyme may be involved in ribosomal RNA synthesis or processing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0382 Product name: Recombinant human DDX50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-381 aa of BC000272 Sequence: EGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDV Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC000272 Gene Symbol: DDX50 Gene ID (NCBI): 79009 RRID: AB_2245834 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQ39 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.