Iright
BRAND / VENDOR: Proteintech

Proteintech, 10360-1-AP, ZNF256 Polyclonal antibody

CATALOG NUMBER: 10360-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF256 (10360-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF256 in WB, ELISA applications with reactivity to human, mouse samples 10360-1-AP targets ZNF256 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ZNF256 as a transcriptional repressor that plays a role in cell proliferation. ZNF256 localizes in the nucleus and contains the KRAB domain that mediates interaction with TRIM28 and is required for transcriptional repressor activity. ZNF256 exists as two isoforms and the calculated molecular weight of isoforms is 55 and 75 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0390 Product name: Recombinant human ZNF256 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 193-441 aa of BC001438 Sequence: KKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGDLIRERSYMCSECGKSFSTSCSLSDHLRVHTSEKPYTCGECGKSYRQSSSLITHRRIHTGVRPHQCDECGKLFNRKYDLLIHQRVHTGERPYKCSECGKSFSHSSSLITHQRIHTGMRPYECSECGKSFIHSSSLITHQRVHTGTRPYMCSECGKSFSQSCHLIKHRRLHIGEGPYECSECGKLFTYRSRFFQHQRVHTGVRSHECHECG Predict reactive species Full Name: zinc finger protein 256 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC001438 Gene Symbol: ZNF256 Gene ID (NCBI): 10172 RRID: AB_2219240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2P7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924