Iright
BRAND / VENDOR: Proteintech

Proteintech, 10361-1-AP, BNIP2 Polyclonal antibody

CATALOG NUMBER: 10361-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BNIP2 (10361-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 10361-1-AP targets BNIP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, MDA-MB-231 cells, SW480 cells Positive IF/ICC detected in: HeLa cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) is also named as PRKACN2. BNIP2 is developmentally regulated may suggest a role of this gene in those brain areas where the differentiation is orchestrated by estradiol. The expression of BNIP2 was inhibited by estradiol. BNIP2 is implicated in the suppression of cell death and interacts with the BCL-2 and adenovirus E1B 19 kDa proteins. BNIP2 is highly expressed in patients with favorable neuroblastoma (NB) (PMID: 25611382). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0403 Product name: Recombinant human BNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-313 aa of BC002461 Sequence: MKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNE Predict reactive species Full Name: BCL2/adenovirus E1B 19kDa interacting protein 2 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC002461 Gene Symbol: BNIP2 Gene ID (NCBI): 663 RRID: AB_3085366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12982 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924