Iright
BRAND / VENDOR: Proteintech

Proteintech, 10364-1-AP, MAPRE2 Polyclonal antibody

CATALOG NUMBER: 10364-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAPRE2 (10364-1-AP) by Proteintech is a Polyclonal antibody targeting MAPRE2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10364-1-AP targets MAPRE2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HCT 116 cells, mouse cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RP1 protein shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family and binds specifically to the C-terminal region of the APC protein. RP1 also binds directly to tubulin, both in vitro and in vivo. The function of RP1 is currently unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. It may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0416 Product name: Recombinant human MAPRE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-327 aa of BC007318 Sequence: QTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY Predict reactive species Full Name: microtubule-associated protein, RP/EB family, member 2 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 39-42 kDa GenBank Accession Number: BC007318 Gene Symbol: MAPRE2 Gene ID (NCBI): 10982 RRID: AB_2141649 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15555 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924