Iright
BRAND / VENDOR: Proteintech

Proteintech, 10379-1-AP, SNRPD3 Polyclonal antibody

CATALOG NUMBER: 10379-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNRPD3 (10379-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD3 in WB, IHC, ELISA applications with reactivity to human samples 10379-1-AP targets SNRPD3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF7 cells, MCF-7 cells Positive IHC detected in: human small intestine tissue, human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Small nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0293 Product name: Recombinant human SNRPD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-119 aa of BC000457 Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG Predict reactive species Full Name: small nuclear ribonucleoprotein D3 polypeptide 18kDa Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC000457 Gene Symbol: SNRPD3 Gene ID (NCBI): 6634 RRID: AB_2286308 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924