Proteintech, 10401-1-AP, RAIDD Polyclonal antibody

Size: 20ul / 150ul RAIDD Polyclonal Antibody for WB, IP, IHC, ELISA 10401-1-AP targets RAIDD in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, HeLa cells, MCF-7 cells, mouse heart tissue, mouse kidney tissue, mouse liver tissue, mouse skeletal muscle tissue, mouse testis tissue, Raji cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information RAIDD, also named as CRADD, is an apoptotic adaptor molecule specific for caspase-2 and FASL/TNF receptor-interacting protein RIP. In the presence of RIP and TRADD, CRADD recruits caspase-2 to the TNFR-1 signalling complex. CRADD interacts with BCL10 through its caspase recruitment domain and suppresses interactions between BCL10 and CARMA1. It is a negative regulator of the CARMA1 signalosome and suppressor of Th1-and Th17-mediated inflammatory responses. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0630 Product name: Recombinant human CRADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC017042 Sequence: MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE Predict reactive species Full Name: CASP2 and RIPK1 domain containing adaptor with death domain Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC017042 Gene Symbol: CRADD Gene ID (NCBI): 8738 RRID: AB_2085477 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78560 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.