Iright
BRAND / VENDOR: Proteintech

Proteintech, 10414-1-AP, BCAS2 Polyclonal antibody

CATALOG NUMBER: 10414-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BCAS2 (10414-1-AP) by Proteintech is a Polyclonal antibody targeting BCAS2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 10414-1-AP targets BCAS2 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, mouse liver tissue, hESC cells, human brain tissue, K-562 cells, COS-7 cells, SH-SY5Y cells, PC-12 cells, C6 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human prostate cancer tissue, human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information BCAS2 associates with the spliceosome and implicates in mRNA splicing Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0669 Product name: Recombinant human BCAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC005285 Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF Predict reactive species Full Name: breast carcinoma amplified sequence 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26-32 kDa GenBank Accession Number: BC005285 Gene Symbol: BCAS2 Gene ID (NCBI): 10286 RRID: AB_2063400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75934 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924