Proteintech, 10417-1-AP, GATA3 Polyclonal antibody

Size: 20ul / 150ul The GATA3 (10417-1-AP) by Proteintech is a Polyclonal antibody targeting GATA3 in WB, ELISA applications with reactivity to human samples 10417-1-AP targets GATA3 in WB, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, T-47D cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression. This is a rabbit polyclonal antibody raised against part of C-terminus of human GATA3. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0174 Product name: Recombinant human GATA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-442 aa of BC003070 Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM Predict reactive species Full Name: GATA binding protein 3 Calculated Molecular Weight: 443 aa, 48 kDa Observed Molecular Weight: 37 kDa and 48 kDa GenBank Accession Number: BC003070 Gene Symbol: GATA3 Gene ID (NCBI): 2625 RRID: AB_2263174 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.