Proteintech, 10432-1-AP, SYNGR1 Polyclonal antibody

Size: 20ul / 150ul The SYNGR1 (10432-1-AP) by Proteintech is a Polyclonal antibody targeting SYNGR1 in WB, IF/ICC, ELISA applications with reactivity to human, rat, pig samples 10432-1-AP targets SYNGR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: rat brain tissue, pig brain Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Synaptogyrins are one of the most abundant vesicle components and are involved in the regulation of neurotransmitter release and synaptic plasticity. Synaptogyrins comprise a family of tyrosine-phosphorylated proteins with three isoforms: two neuronal forms (synaptogyrin-1 and -3) and one ubiquitous form (synaptogyrin-2). The synaptogyrin 1 (SYNGR1) can act as a regulator of Ca2+-dependent exocytosis. SYNGR1 protein mutations are associated with schizophrenia and are considered to be positional candidate genes for schizophrenia.(PMID: 10383386; 10595519; 14755516; 14732601; 17049558) Specification Tested Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0685 Product name: Recombinant human SYNGR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC000731 Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP Predict reactive species Full Name: synaptogyrin 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC000731 Gene Symbol: SYNGR1 Gene ID (NCBI): 9145 RRID: AB_2200874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43759 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.