Iright
BRAND / VENDOR: Proteintech

Proteintech, 10435-1-AP, BAD Polyclonal antibody

CATALOG NUMBER: 10435-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BAD (10435-1-AP) by Proteintech is a Polyclonal antibody targeting BAD in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 10435-1-AP targets BAD in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HepG2 cells, Neuro-2a cells Positive IHC detected in: human prostate hyperplasia tissue, human prostate cancer tissue, mouse liver tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:100-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information BAD, also named as BBC6 and BCL2L8, promotes cell death. It is successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. BAD can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. It appears to act as a link between growth factor receptor signaling and the apoptotic pathways. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, canine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0688 Product name: Recombinant human BAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-168 aa of BC001901 Sequence: DSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ Predict reactive species Full Name: BCL2-associated agonist of cell death Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18-25 kDa GenBank Accession Number: BC001901 Gene Symbol: BAD Gene ID (NCBI): 572 RRID: AB_2061994 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92934 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924