Iright
BRAND / VENDOR: Proteintech

Proteintech, 10436-1-AP, Caspase 2/P32/P18 Polyclonal antibody

CATALOG NUMBER: 10436-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Caspase 2/P32/P18 (10436-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 2/P32/P18 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10436-1-AP targets Caspase 2/P32/P18 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Staurosporine treated Jurkat cells, HeLa cells, mouse liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information CASP2(Caspase-2) is also named as ICH1, NEDD2 and belongs to the peptidase C14A family.It is involved in the activation cascade of caspases responsible for apoptosis execution and might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.It has 2 isoforms produced by alternative splicing and can exists almost as a dimer in solution(PMID:15865942). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0694 Product name: Recombinant human Caspase 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-217 aa of BC002427 Sequence: MAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELE Predict reactive species Full Name: caspase 2, apoptosis-related cysteine peptidase Calculated Molecular Weight: 452 aa, 51 kDa Observed Molecular Weight: 48-51 kDa, 32 kDa, 18kDa GenBank Accession Number: BC002427 Gene Symbol: Caspase 2 Gene ID (NCBI): 835 RRID: AB_2228450 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924