Iright
BRAND / VENDOR: Proteintech

Proteintech, 10450-1-AP, Connexin 32 Polyclonal antibody

CATALOG NUMBER: 10450-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Connexin 32 (10450-1-AP) by Proteintech is a Polyclonal antibody targeting Connexin 32 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10450-1-AP targets Connexin 32 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, A375 cells, human liver tissue, mouse skin tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Connexin 32 (Cx32), also known as Gap junction beta 1 protein (GJB1), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Connexin 32 is the major gap junction protein of liver, and the expression is also found in the brain and other organs. It is involved in tumorigenesis and liver regeneration. Connexin 32 plays an important role in peripheral nerve. Defects in Connexin 32 are the cause of Charcot-Marie-Tooth disease X-linked type 1 (CMTX1), an inherited peripheral neuropathy. Connexin 32 protein can be detected as a 27-32 kDa monomer and a 48-54 kDa dimer (PMID: 8266101; 8613761; 8608591; 19265674; 17972320; 19845480) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0659 Product name: Recombinant human Cx32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-283 aa of BC002805 Sequence: TYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC Predict reactive species Full Name: gap junction protein, beta 1, 32kDa Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC002805 Gene Symbol: Connexin-32 Gene ID (NCBI): 2705 RRID: AB_2110629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08034 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924