Iright
BRAND / VENDOR: Proteintech

Proteintech, 10453-1-AP, SLC45A2 Polyclonal antibody

CATALOG NUMBER: 10453-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC45A2 (10453-1-AP) by Proteintech is a Polyclonal antibody targeting SLC45A2 in IHC, ELISA applications with reactivity to human, mouse samples 10453-1-AP targets SLC45A2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse colon tissue, human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC45A2, also named as AIM1 and MATP, belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a melanocyte differentiation antigen. SLC45A2 may transport substances required for melanin biosynthesis. (PMID:17768386,21677667)Mutation of SLC45A2 cause oculocutaneous albinism type 4 (OCA4) which is disorder of pigmentation characterized by reduced biosynthesis of melanin in the skin, hair and eyes. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0699 Product name: Recombinant human SLC45A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC003597 Sequence: MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFI Predict reactive species Full Name: solute carrier family 45, member 2 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC003597 Gene Symbol: SLC45A2 Gene ID (NCBI): 51151 RRID: AB_2191075 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924