Iright
BRAND / VENDOR: Proteintech

Proteintech, 10457-1-AP, UBC Polyclonal antibody

CATALOG NUMBER: 10457-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBC (10457-1-AP) by Proteintech is a Polyclonal antibody targeting UBC in IHC, ELISA applications with reactivity to human, mouse, rat samples 10457-1-AP targets UBC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse liver tissue, human lung cancer tissue, human urothelial carcinoma tissue, mouse stomach tissue, rat liver tissue, rat pancreas tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ubiquitin (Ub) is a small, highly conserved eukaryotic protein that has an essential role in diverse cellular signaling pathways, including targeting proteins for proteasomal degradation. Cellular Ub is comprised of two distinct pools consisting of free Ub and Ub-substrate conjugates. UbC is a polyubiquitine gene that encodes Ub polyprotein. UbC, as stress-inducible polyubiquitin precursor proteins of around 9-11 monomers, is cleaved into monomeric ubiquitin by cellular deubiquitylating enzymes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0711 Product name: Recombinant human UBC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-265 aa of BC008955 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE Predict reactive species Full Name: ubiquitin C Calculated Molecular Weight: 60 kDa GenBank Accession Number: BC008955 Gene Symbol: UBC Gene ID (NCBI): 7316 RRID: AB_2241301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0CG48 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924