Iright
BRAND / VENDOR: Proteintech

Proteintech, 10475-1-AP, TCL1A Polyclonal antibody

CATALOG NUMBER: 10475-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCL1A (10475-1-AP) by Proteintech is a Polyclonal antibody targeting TCL1A in WB, IHC, ELISA applications with reactivity to human samples 10475-1-AP targets TCL1A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human tonsillitis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information TCL1A, also named TCL1 and p14 TCL1, enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. TCL1A immunodetection is an independent marker of adverse outcome that could be used in routine settings for the management of DLCL patients. TCL1A expression is correlated with shorter time to treatment in chronic lymphocytic leukemia cases and shorter lymphoma-specific survival in mantle cell lymphoma series. It is a potential therapeutic target. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0786 Product name: Recombinant human TCL1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC005831 Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Predict reactive species Full Name: T-cell leukemia/lymphoma 1A Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC005831 Gene Symbol: TCL1A Gene ID (NCBI): 8115 RRID: AB_2255885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924