Proteintech, 10483-1-AP, EEF1B2 Polyclonal antibody

Size: 20ul / 150ul The EEF1B2 (10483-1-AP) by Proteintech is a Polyclonal antibody targeting EEF1B2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10483-1-AP targets EEF1B2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, SKOV-3 cells, mouse kidney tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information In eukaryotes, the translation elongation factor eEF1A responsible for transporting amino-acylated tRNA to the ribosome forms a higher-order complex, eEF1H, with its guanine-nucleotide-exchange factor eEF1B. eEF1B consists of three subunits: eEF1B alpha, eEF1B beta and eEF1B gamma. The eEF1B2 possess the nucleotide-exchange activity. Although several models on the basis of in vitro experiments have been proposed for the macromolecular organization of the eEF1H complex, these models differ in various aspects. The human eukaryote elongation factor 1 beta 2 (eEF1B2) migrated as a 30 kDa protein in SDS-PAGE. This antibody is a rabbit polyclonal antibody raised against full length EEF1B2 of human origin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0742 Product name: Recombinant human EEF1B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC004931 Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI Predict reactive species Full Name: eukaryotic translation elongation factor 1 beta 2 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC004931 Gene Symbol: EEF1B2 Gene ID (NCBI): 1933 RRID: AB_2096985 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.