Iright
BRAND / VENDOR: Proteintech

Proteintech, 10530-1-AP, PDLIM5 Polyclonal antibody

CATALOG NUMBER: 10530-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDLIM5 (10530-1-AP) by Proteintech is a Polyclonal antibody targeting PDLIM5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10530-1-AP targets PDLIM5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells, A549 cells, HeLa cells, NIH/3T3 cells, MCF-7 cells, MDA-MB-231 cells Positive IP detected in: HeLa cells Positive IHC detected in: human stomach cancer tissue, mouse heart tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDLIM5 (PDZ and LIM domain 5), formerly known as enigma homolog (ENH), is a cytoplasmic protein containing PDZ domain and LIM domain at N terminus and C terminus, respectively. PDLIM5 gene generates several splicing variants, EZH1 to EZH4. The long isoform, ENH1, is widely expressed in various tissues including heart, brain, spleen, liver and kidney. In comparison, shorter isoforms that lack the LIM motifs are expressed in cardiac (ENH3) and skeletal muscle (ENH2, ENH3, and ENH4). ENH1 is essential for differentiation of striated muscles through interaction with other proteins. In addition, PDLIM5 is also involved in mood disorders, such as schizophrenia, bipolar disorder, and major depression. This antibody is specific to PDLIM5, and its specificity has been confirmed by siRNA test. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0808 Product name: Recombinant human PDLIM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-596 aa of BC008741 Sequence: PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF Predict reactive species Full Name: PDZ and LIM domain 5 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 63-68 kDa GenBank Accession Number: BC008741 Gene Symbol: PDLIM5 Gene ID (NCBI): 10611 RRID: AB_2161779 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96HC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924