Proteintech, 10531-1-AP, DAD1 Polyclonal antibody

Size: 20ul / 150ul The DAD1 (10531-1-AP) by Proteintech is a Polyclonal antibody targeting DAD1 in WB, IHC, IP, ELISA applications with reactivity to human samples 10531-1-AP targets DAD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DAD1 (defender against cell death 1) is a downstream target of the NFkB survival pathway and exhibits an antiapoptotic function. It is also named as OST2 (Oligosaccharyl transferase2) and catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Increased expression of DAD1 has been observed in various tumors. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0814 Product name: Recombinant human DAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC007403 Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG Predict reactive species Full Name: defender against cell death 1 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC007403 Gene Symbol: DAD1 Gene ID (NCBI): 1603 RRID: AB_2089878 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61803 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.