Iright
BRAND / VENDOR: Proteintech

Proteintech, 10537-1-AP, Dermatopontin Polyclonal antibody

CATALOG NUMBER: 10537-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Dermatopontin (10537-1-AP) by Proteintech is a Polyclonal antibody targeting Dermatopontin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10537-1-AP targets Dermatopontin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, rat skin tissue, human skeletal muscle tissue Positive IHC detected in: human pancreas tissue, rat testis tissue, human testis tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DPT (dermatopontin) is an extracellular matrix protein belonging to the dermatopontin family. Skin appears to be the richest source of dermatopontin, comprising about 15 mg/kg of the wet weight. Expression of dermatopontin is not limited to connective tissue, as investigations show that dermatopontin mRNA is expressed in cultured fibroblasts, muscle, heart, pancreas, and lung. Dermatopontin comprises a considerable proportion of the noncollagenous extracellular matrix proteins. It is involved in promotion of cellular adhesion, extracellular matrix assembly, wound healing, and positive modification of the growth inhibition activity of TGF-beta1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0801 Product name: Recombinant human DPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC033736 Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV Predict reactive species Full Name: dermatopontin Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC033736 Gene Symbol: DPT/TRAMP Gene ID (NCBI): 1805 RRID: AB_2230721 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07507 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924