Iright
BRAND / VENDOR: Proteintech

Proteintech, 10547-1-AP, IRF5 Polyclonal antibody

CATALOG NUMBER: 10547-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRF5 (10547-1-AP) by Proteintech is a Polyclonal antibody targeting IRF5 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10547-1-AP targets IRF5 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells, SH-SY5Y cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IRF5, also named as SLEB10, contians one IRF tryptophan pentad repeat DNA-binding domain and belongs to the IRF family. It is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. It is activated by TLR7 or TLR8 signaling. Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14) and systemic lupus erythematosus type 10 (SLEB10). Alternative splice variant encoding different isoforms exist. Catalog#10547-1-AP is a rabbit polyclonal antibody raised against the C-terminal of human IRF5. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0841 Product name: Recombinant human IRF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 173-498 aa of BC004201 Sequence: TLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ Predict reactive species Full Name: interferon regulatory factor 5 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC004201 Gene Symbol: IRF5 Gene ID (NCBI): 3663 RRID: AB_2280474 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924