Iright
BRAND / VENDOR: Proteintech

Proteintech, 10552-1-AP, MOG1 Polyclonal antibody

CATALOG NUMBER: 10552-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MOG1 (10552-1-AP) by Proteintech is a Polyclonal antibody targeting MOG1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10552-1-AP targets MOG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SGC-7901 cells, HepG2 cells, mouse lung tissue, mouse testis tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RANGRF, also named as MOG1, RANGNRF, HSPC165, HSPC236 and MDS5, regulates the intracellular trafficking of RAN. In cardiac cells it regulates the cell surface localization of SCN5A. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0824 Product name: Recombinant human RANGRF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC006486 Sequence: MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVRARECVMSWKGGSGDAEIQVSILTLIPLGSKGRDTSSGLAEAAPVPD Predict reactive species Full Name: RAN guanine nucleotide release factor Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC006486 Gene Symbol: RANGRF Gene ID (NCBI): 29098 RRID: AB_2238173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HD47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924