Proteintech, 10600-1-AP, CD24 Polyclonal antibody

Size: 20ul / 150ul The CD24 (10600-1-AP) by Proteintech is a Polyclonal antibody targeting CD24 in WB, ELISA applications with reactivity to human, mouse, rat samples 10600-1-AP targets CD24 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, mouse brain tissue, rat spleen tissue, Jurkat cells, MCF-7 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0654 Product name: Recombinant human CD24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species Full Name: CD24 molecule Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 30-70 kDa GenBank Accession Number: BC007674 Gene Symbol: CD24 Gene ID (NCBI): 100133941 RRID: AB_10646440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25063 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.