Proteintech, 10632-1-AP, RHOC Polyclonal antibody

Size: 20ul / 150ul The RHOC (10632-1-AP) by Proteintech is a Polyclonal antibody targeting RHOC in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10632-1-AP targets RHOC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, C6 cells, HeLa cells Positive IP detected in: A549 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information Ras homolog family member C (RHOC) encodes a Rho-related GTP-binding protein, which belongs to small GTPase superfamily and also Rho family. RHOC. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Expression of RHOC contributes to metastatic phenotype of melanoma cells and is associated with multiple cancers including gastric carcinomas, ovarian carcinomas and breast cancer as well. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0988 Product name: Recombinant human RHOC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC007245 Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL Predict reactive species Full Name: ras homolog gene family, member C Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC007245 Gene Symbol: RHOC Gene ID (NCBI): 389 RRID: AB_10898358 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08134 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.