Iright
BRAND / VENDOR: Proteintech

Proteintech, 10641-1-AP, TDP1 Polyclonal antibody

CATALOG NUMBER: 10641-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TDP1 (10641-1-AP) by Proteintech is a Polyclonal antibody targeting TDP1 in WB, IHC, IP, ELISA applications with reactivity to human samples 10641-1-AP targets TDP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF7 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tyrosyl DNA phosphodiesterase 1 (TDP1) is an enzyme capable of hydrolyzing phosphodiester bonds between tyrosine and the 3-phosphate of DNA, which are typically generated in a transient manner by DNA topoisomerase I (topo I) and it appears to be more mobile and diffusible than topo I, and it has a different distribution in the nucleus (PMID:15494395). TDP1 is involed in protecting cells against oxidative DNA damage, and with the impaired ability of TDP1-deficient cells to remove 3-phosphoglycolate (PMID:21041670). Defects in TDP1 are the cause of spinocerebellar ataxia autosomal recessive with axonal neuropathy (SCAN1)(PMID:17948061). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0964 Product name: Recombinant human TDP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-298 aa of BC006083 Sequence: MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGTHL Predict reactive species Full Name: tyrosyl-DNA phosphodiesterase 1 Calculated Molecular Weight: 34 kDa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC006083 Gene Symbol: TDP1 Gene ID (NCBI): 55775 RRID: AB_2240520 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924