Proteintech, 10650-1-AP, DPP3 Polyclonal antibody

Size: 20ul / 150ul The DPP3 (10650-1-AP) by Proteintech is a Polyclonal antibody targeting DPP3 in WB, ELISA applications with reactivity to human, mouse samples 10650-1-AP targets DPP3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DPP3 (dipeptidyl-peptidase 3), also known as DPPIII, is one of the dipeptidyl aminopeptidases, that belongs to the peptidase M49 family. DPP3 is a metalloenzyme containing one Zn2+ ion in its active site. Furthermore, It was shown to have a novel zinc-binding motif ( HELLGH). DPP3 has been reported as an important enkephalin-degrading enzyme in the central nervous system, in human neutrophils.It has 3 isoforms produced by alternative splicing. Increased activity of DPP3 is associated with endometrial and ovarian cancers. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1022 Product name: Recombinant human DPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 437-737 aa of BC007221 Sequence: LWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA Predict reactive species Full Name: dipeptidyl-peptidase 3 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 69 kDa, 83 kDa GenBank Accession Number: BC007221 Gene Symbol: DPP3 Gene ID (NCBI): 10072 RRID: AB_2093553 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.