Proteintech, 10661-1-AP, XPNPEP1 Polyclonal antibody

Size: 20ul / 150ul The XPNPEP1 (10661-1-AP) by Proteintech is a Polyclonal antibody targeting XPNPEP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10661-1-AP targets XPNPEP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse small intestine tissue, rat pancreas tissue Positive IHC detected in: human small intestine tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1015 Product name: Recombinant human XPNPEP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 323-623 aa of BC007579 Sequence: NSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH Predict reactive species Full Name: X-prolyl aminopeptidase (aminopeptidase P) 1, soluble Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC007579 Gene Symbol: XPNPEP1 Gene ID (NCBI): 7511 RRID: AB_2215792 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQW7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.