Iright
BRAND / VENDOR: Proteintech

Proteintech, 10676-1-AP, FABP3 Polyclonal antibody

CATALOG NUMBER: 10676-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FABP3 (10676-1-AP) by Proteintech is a Polyclonal antibody targeting FABP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 10676-1-AP targets FABP3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat testis tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Positive IHC detected in: mouse heart tissue, human skin tissue, human lung tissue, human ovary tissue, human breast cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1069 Product name: Recombinant human FABP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species Full Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC007021 Gene Symbol: FABP3 Gene ID (NCBI): 2170 RRID: AB_2102309 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05413 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924