Proteintech, 10689-1-AP, MMS2 Polyclonal antibody

Size: 20ul / 150ul The MMS2 (10689-1-AP) by Proteintech is a Polyclonal antibody targeting MMS2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10689-1-AP targets MMS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A375 cells, HeLa cells, HL-60 cells, human brain tissue, Jurkat cells, K-562 cells, rat liver tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information MMS2 encodes a 137-amino acid, 15.2-kDa protein with significant sequence homology to a conserved family of ubiquitin-conjugating (Ubc) proteins (PMID: 9576943). Mms2 is a ubiquitin E2-variant protein with a very well-documented function in the tolerance pathway that protects both human and yeast cells from the lethal and mutagenic effects of DNA damage (PMID: 36934633). A high expression level of human MMS2 is associated with poor survival prognosis in different cancer diseases (PMID: 36934633). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1111 Product name: Recombinant human UBE2V2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC007051 Sequence: MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN Predict reactive species Full Name: ubiquitin-conjugating enzyme E2 variant 2 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC007051 Gene Symbol: MMS2 Gene ID (NCBI): 7336 RRID: AB_2211656 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15819 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.