Iright
BRAND / VENDOR: Proteintech

Proteintech, 10690-1-AP, GMF Beta Polyclonal antibody

CATALOG NUMBER: 10690-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GMF Beta (10690-1-AP) by Proteintech is a Polyclonal antibody targeting GMF Beta in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 10690-1-AP targets GMF Beta in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human heart tissue, human brain tissue, PC-12 cells, mouse heart tissue, rat brain tissue, SH-SY5Y cells, U-87 MG cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive FC (Intra) detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information GMFB, Glia maturation factor beta, is a nerve growth factor implicated in nervous system development. It was reported that GMF-beta promotes the phenotypic expression of glia and neurons and inhibits the proliferation of their respective tumors in culture cells. GMF-beta protein is specific to the brain where it is expressed in glial cells (mainly astrocytes) and insome neurons. Higher levels of GMFB were found in the central nervous system, except for the spinal cord, and in thymus and colon. GMFB was positive in the cytoplasm and nuclei of all cells in whole brain. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1104 Product name: Recombinant human GMFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC005359 Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY Predict reactive species Full Name: glia maturation factor, beta Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC005359 Gene Symbol: GMFB Gene ID (NCBI): 2764 RRID: AB_2110837 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60983 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924