Iright
BRAND / VENDOR: Proteintech

Proteintech, 10706-1-AP, HSF2 Polyclonal antibody

CATALOG NUMBER: 10706-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSF2 (10706-1-AP) by Proteintech is a Polyclonal antibody targeting HSF2 in WB, IHC, ELISA applications with reactivity to human, Mouse, rat samples 10706-1-AP targets HSF2 in WB, IHC, ELISA applications and shows reactivity with human, Mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, A549 cells Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, Mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1067 Product name: Recombinant human HSF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC005329 Sequence: MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF Predict reactive species Full Name: heat shock transcription factor 2 Calculated Molecular Weight: 79 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC005329 Gene Symbol: HSF2 Gene ID (NCBI): 3298 RRID: AB_2120443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924