Product Description
Size: 20ul / 150ul
The CXCL11 (10707-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL11 in WB, IHC, ELISA applications with reactivity to human samples
10707-1-AP targets CXCL11 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: IFN gamma, LPS and Brefeldin A treated THP-1 cells
Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), is a member of the ELR-negative CXC chemokine family. It is produced by various cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). CXCL11 signals through the chemokine receptors CXCR3 and CXCR7 . This chemokine is associated with multiple functions such as chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1087 Product name: Recombinant human CXCL11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC005292 Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF Predict reactive species
Full Name: chemokine (C-X-C motif) ligand 11
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC005292
Gene Symbol: CXCL11
Gene ID (NCBI): 6373
RRID: AB_2088022
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14625
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924