Proteintech, 10728-1-AP, PRPF4 Polyclonal antibody

Size: 20ul / 150ul The PRPF4 (10728-1-AP) by Proteintech is a Polyclonal antibody targeting PRPF4 in WB, IHC, ELISA applications with reactivity to human samples 10728-1-AP targets PRPF4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells, HEK-293 cells, HepG2 cells, K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:10-1:100 Background Information PRPF4, also named as U4/U6 small nuclear ribonucleoprotein Prp4, is a 522 amino acid protein, which contains seven WD repeats. PRPF4 localizes in the Nucleus speckle. PRPF4 participates in pre-mRNA splicing and is a part of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.PRPF4-mediated phosphorylation of KLF13 plays a role in the regulation of CCL5 expression in T lymphocytes Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1193 Product name: Recombinant human PRPF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-522 aa of BC001588 Sequence: ELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE Predict reactive species Full Name: PRP4 pre-mRNA processing factor 4 homolog (yeast) Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC001588 Gene Symbol: PRPF4 Gene ID (NCBI): 9128 RRID: AB_2171027 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.