Proteintech, 10735-1-AP, RAC2 Polyclonal antibody

Size: 20ul / 150ul The RAC2 (10735-1-AP) by Proteintech is a Polyclonal antibody targeting RAC2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10735-1-AP targets RAC2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HL-60 cells, mouse spleen tissue, rat spleen tissue Positive IP detected in: HL-60 cells Positive IHC detected in: human tonsillitis tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAC2, also named as GX, belongs to the small GTPase superfamily and Rho family. RAC2 is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. RAC2 augments the production of reactive oxygen species (ROS) by NADPH oxidase. Defects in RAC2 are the cause of neutrophil immunodeficiency syndrome. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1202 Product name: Recombinant human RAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC001485 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL Predict reactive species Full Name: ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC001485 Gene Symbol: RAC2 Gene ID (NCBI): 5880 RRID: AB_2176127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15153 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.