Proteintech, 10741-1-AP, DTNA Polyclonal antibody

Size: 20ul / 150ul The DTNA (10741-1-AP) by Proteintech is a Polyclonal antibody targeting DTNA in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 10741-1-AP targets DTNA in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1500 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information DTNA (dystorbrevin alpha) is a cytoskeleton associated protein and an essential component of dystrophin protein complex. It is highly expressed in brain, heart and skeletal muscle. Alternative splicing generates several isoforms ranging from 22 to 84 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1075 Product name: Recombinant human DTNA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-371 aa of BC005300 Sequence: MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSSDGAFGGCV Predict reactive species Full Name: dystrobrevin, alpha Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 25, 49-59 kDa, 78-85 kDa GenBank Accession Number: BC005300 Gene Symbol: DTNA Gene ID (NCBI): 1837 RRID: AB_2093895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4J8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.