Iright
BRAND / VENDOR: Proteintech

Proteintech, 10748-1-AP, DARPP32 Polyclonal antibody

CATALOG NUMBER: 10748-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DARPP32 (10748-1-AP) by Proteintech is a Polyclonal antibody targeting DARPP32 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 10748-1-AP targets DARPP32 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP32) , also known as protein phosphatase 1 regulatory subunit 1B (PPP1R1B), is a substrate of cAMP-dependent protein kinase (PKA) enriched in dopamine-innervated brain areas. Overexpression of DARPP32 has been shown to block gefitinib-induced apoptosis in gastric tumors by promoting EGFR and ERBB3 heterodimerization (PMID: 21741919). DARPP32 also drives gefitinib-refractory lung tumor growth through similar ERBB3-mediated resistance mechanisms(PMID: 34675407). The molecular weight of DARPP32 is about 32 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1216 Product name: Recombinant human DARPP32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC001519 Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 1B Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC001519 Gene Symbol: DARPP32 Gene ID (NCBI): 84152 RRID: AB_2300051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UD71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924