Iright
BRAND / VENDOR: Proteintech

Proteintech, 10766-1-AP, PRG2 Polyclonal antibody

CATALOG NUMBER: 10766-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRG2 (10766-1-AP) by Proteintech is a Polyclonal antibody targeting PRG2 in IHC, ELISA applications with reactivity to human samples 10766-1-AP targets PRG2 in IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PRG2, also known as BMPG, has 222 amino acid residues with a 16 N-terminal signal sequence, so the mature form has 206 amino acid residues. High levels of PRG2 are present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein can be cleaved into eosinophil granule major basic protein (MBP), which is the major constituent of the crystalline core of the eosinophil granule. MBP is highly basic and toxic to both mammalian cells and parasites, and it functions in the defense against invading parasites (PMID: 21270431). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1150 Product name: Recombinant human PRG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC005929 Sequence: MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY Predict reactive species Full Name: proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) Calculated Molecular Weight: 25 kDa GenBank Accession Number: BC005929 Gene Symbol: PRG2 Gene ID (NCBI): 5553 RRID: AB_2169223 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13727 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924