Iright
BRAND / VENDOR: Proteintech

Proteintech, 10779-1-AP, TCEB2/Elongin-B Polyclonal antibody

CATALOG NUMBER: 10779-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCEB2/Elongin-B (10779-1-AP) by Proteintech is a Polyclonal antibody targeting TCEB2/Elongin-B in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 10779-1-AP targets TCEB2/Elongin-B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, mouse skeletal muscle tissue, HEK-293 cells, HeLa cells, K-562 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex and is also reported to function as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes (PMID: 26531153). TCEB2 has 2 isoforms with the molecular mass of 13 and 18 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1228 Product name: Recombinant human TCEB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC013306 Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ Predict reactive species Full Name: transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC013306 Gene Symbol: TCEB2 Gene ID (NCBI): 6923 RRID: AB_2240375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15370 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924