Iright
BRAND / VENDOR: Proteintech

Proteintech, 10805-1-AP, EEF1E1 Polyclonal antibody

CATALOG NUMBER: 10805-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EEF1E1 (10805-1-AP) by Proteintech is a Polyclonal antibody targeting EEF1E1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10805-1-AP targets EEF1E1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human testis tissue, Jurkat cells, HepG2 cells, SKOV-3 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information During the translation processes, aminoacyl-tRNA synthetases (ARSs) ligate specific amino acids to tRNAs. Together with non-enzymatic proteins called ARS-interacting multifunctional proteins (AIMPs), the ARSs form a macromolecular complex [PMID:15286174]. This complex has an essential role in protein synthesis, but also in other biological processes including angiogenesis, apoptosis, and inflammation. [PMID:21789020] AIMP3 is not only associated with the multi-tRNA synthetase complex via its specific interaction with methionyl-tRNA synthetase, but also works as a tumor suppressor by interacting with ATM, the upstream kinase of p53 [PMID:18343821]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1092 Product name: Recombinant human EEF1E1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-174 aa of BC005291 Sequence: MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH Predict reactive species Full Name: eukaryotic translation elongation factor 1 epsilon 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC005291 Gene Symbol: EEF1E1 Gene ID (NCBI): 9521 RRID: AB_2097140 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43324 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924