Proteintech, 10847-1-AP, MST4 Polyclonal antibody

Size: 20ul / 150ul The MST4 (10847-1-AP) by Proteintech is a Polyclonal antibody targeting MST4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10847-1-AP targets MST4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, HL-60 cells, MCF-7 cells, L02 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human liver tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1302 Product name: Recombinant human MST4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC017213 Sequence: MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP Predict reactive species Full Name: serine/threonine protein kinase MST4 Calculated Molecular Weight: 16 kDa, 46 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: BC017213 Gene Symbol: MST4 Gene ID (NCBI): 51765 RRID: AB_513907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P289 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.