Proteintech, 10890-1-AP, KIRREL2 Polyclonal antibody

Size: 20ul / 150ul The KIRREL2 (10890-1-AP) by Proteintech is a Polyclonal antibody targeting KIRREL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 10890-1-AP targets KIRREL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1036 Product name: Recombinant human KIRREL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC007312 Sequence: MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV Predict reactive species Full Name: kin of IRRE like 2 (Drosophila) Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 67 kDa, 90 kDa GenBank Accession Number: BC007312 Gene Symbol: KIRREL2 Gene ID (NCBI): 84063 RRID: AB_2130842 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UWL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.