Proteintech, 10899-1-AP, EIF3E Polyclonal antibody

Size: 20ul / 150ul The EIF3E (10899-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3E in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10899-1-AP targets EIF3E in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat lymph tissue, HeLa cells, mouse thymus tissue, mouse pancreas tissue, Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1132 Product name: Recombinant human EIF3E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-445 aa of BC008419 Sequence: SGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit E Calculated Molecular Weight: 445 aa, 52 kDa Observed Molecular Weight: 48-52 kDa GenBank Accession Number: BC008419 Gene Symbol: EIF3E Gene ID (NCBI): 3646 RRID: AB_2096898 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.