Product Description
Size: 20ul / 150ul
The VPS18 (10901-1-AP) by Proteintech is a Polyclonal antibody targeting VPS18 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples
10901-1-AP targets VPS18 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse brain tissue
Positive IP detected in: HeLa cells
Positive IHC detected in: human lung cancer tissue, human testis tissue, mouse brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1140 Product name: Recombinant human VPS18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species
Full Name: vacuolar protein sorting 18 homolog (S. cerevisiae)
Calculated Molecular Weight: 110 kDa
Observed Molecular Weight: 100-110 kDa
GenBank Accession Number: BC001513
Gene Symbol: VPS18
Gene ID (NCBI): 57617
RRID: AB_2273089
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9P253
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924