Iright
BRAND / VENDOR: Proteintech

Proteintech, 10906-1-AP, Myosin Light Chain 2/MLC-2V Polyclonal antibody

CATALOG NUMBER: 10906-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Myosin Light Chain 2/MLC-2V (10906-1-AP) by Proteintech is a Polyclonal antibody targeting Myosin Light Chain 2/MLC-2V in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, zebrafish samples 10906-1-AP targets Myosin Light Chain 2/MLC-2V in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse heart tissue, human heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF-Fro detected in: mouse heart tissue Positive FC (Intra) detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information BackgroundMYL2 belongs to the myosin family of motor proteins. Their common features are ATP hydrolysis, actin binding, and potential for kinetic energy transduction. MYL2 stands for Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2), also known as the regulatory light chain of myosin (RLC). This isoform is distinct from those expressed in skeletal muscle (MYLPF), smooth muscle (MYL12B), and cardiac atrial muscle (MYL7) (PMID: 21345328). Due to its tissue specificity, MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.What is the molecular weight of MYL2?There are two isoforms of this protein in humans that differ only slightly in length and produce proteins composed of 152 and 166 aa, which correspond to about 19 kDa (PMID: 16678204).What is the subcellular localization of MYL2?It is uniquely expressed in the cytoplasm of heart muscles. It colocalizes with actin cytoskeleton staining.What is the tissue specificity of MYL2?MYL2 is specifically expressed in ventricular cardiac tissue.What is the function of MYL2 in cardiac tissue?MYL2 is a contractile protein that plays a role in heart development and function. During cardiogenesis it plays an early role in cardiac contractility by promoting cardiac myofibril assembly and represents one of the earliest markers of ventricular specification (PMID 8506363).In general, MYL2 interacts with the neck/tail region of the muscle thick filament protein myosin to regulate myosin motility and function (PMID 8316858). Its N-terminal domain is responsible for calcium and magnesium binding at their activating concentrations. This induces a functionally important conformational change (PMID: 18202317). However, the ion dissociation rate is not fast enough to modulate cardiac contractility on a beat-by-beat basis (PMIDs: 188447, 8804617). In addition, RLC function can be modulated by posttranslational modifications such as phosphorylation anddeamidationin the N-terminal region. As a result, a significant change in the charge of the protein is introduced, which undoubtedly alters its interaction with the C-terminal myosin alpha-helical domain (PMID: 26074085).What is MYL2's involvement in disease?Diseases associated with MYL2 dysfunction include forms of familial hypertrophic cardiomyopathies, congenital fiber-type disproportion, and heart failure (PMID: 26074085). Specification Tested Reactivity: human, mouse, rat, zebrafish Cited Reactivity: human, mouse, rat, pig, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1356 Product name: Recombinant human MYL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC015821 Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Predict reactive species Full Name: myosin, light chain 2, regulatory, cardiac, slow Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC015821 Gene Symbol: Myosin Light Chain 2 Gene ID (NCBI): 4633 RRID: AB_2147453 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10916 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924