Iright
BRAND / VENDOR: Proteintech

Proteintech, 10912-1-AP, NUDT3/4/10/11 Polyclonal antibody

CATALOG NUMBER: 10912-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUDT3/4/10/11 (10912-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT3/4/10/11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10912-1-AP targets NUDT3/4/10/11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IHC detected in: mouse testis tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information NUDT11 (nucleoside diphosphate linked moiety X-type motif 11), also named as DIPP3B or APS1, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3/4/10/11). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1346 Product name: Recombinant human NUDT11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC009942 Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 11 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC009942 Gene Symbol: NUDT11 Gene ID (NCBI): 55190 RRID: AB_2153836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96G61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924