Proteintech, 10952-1-AP, CTDSP1 Polyclonal antibody

Size: 20ul / 150ul The CTDSP1 (10952-1-AP) by Proteintech is a Polyclonal antibody targeting CTDSP1 in WB, ELISA applications with reactivity to human, mouse samples 10952-1-AP targets CTDSP1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CTDSP1 also named as NIF3, NLIIF, or SCP1, is a 261 amino acid protein, which contains one FCP1 homology domain. CTDSP1 localizes in the nucleus and colocalizes with RNA polymerase II. CTDSP1 is expressed in non-neuronal tissues. It is highly expressed in skeletal muscle, spleen, lung and placenta. CTDSP1 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1410 Product name: Recombinant human CTDSP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC012977 Sequence: MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS Predict reactive species Full Name: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29-33 kDa GenBank Accession Number: BC012977 Gene Symbol: CTDSP1 Gene ID (NCBI): 58190 RRID: AB_2087073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZU7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.