Proteintech, 11002-1-AP, MIPEP Polyclonal antibody

Size: 20ul / 150ul The MIPEP (11002-1-AP) by Proteintech is a Polyclonal antibody targeting MIPEP in WB, IHC, ELISA applications with reactivity to human samples 11002-1-AP targets MIPEP in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MIPEP(Mitochondrial intermediate peptidase) is also named as MIP and belongs to the peptidase M3 family. It performs the final step in processing a specific class of nuclear-encoded proteins targeted to the mitochondrial matrix or inner membrane. The enzyme is a monomer of 75 kDa with a transit peptide and about 20% of the fmal MIP preparation consists of equimolar amounts of two peptides of 47 kDa and 28 kDa, which are apparently the products of a single cleavage of the 75 kDa protein. MIP is an independent endopeptidase acting on mitochondrial intermediate proteins as substrates.(PMID:1322290). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1451 Product name: Recombinant human MIPEP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC009934 Sequence: MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTELLVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLYQSLQKLLADKKLVDSLDPETRRVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAAYKIFLYPNAGQLKCLEELLSSRDLLAKLVGYSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWD Predict reactive species Full Name: mitochondrial intermediate peptidase Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC009934 Gene Symbol: MIPEP Gene ID (NCBI): 4285 RRID: AB_2235137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.