Iright
BRAND / VENDOR: Proteintech

Proteintech, 11012-1-AP, EIF4H Polyclonal antibody

CATALOG NUMBER: 11012-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF4H (11012-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4H in WB, ELISA applications with reactivity to human samples 11012-1-AP targets EIF4H in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information eukaryotic initiation factor (eIF)4H, which encoded by the gene for HUMORFU_1, functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. And its homolog in human, WBSCR1, located on 7q11, is commonly missed in patients suffered the Williams-Beuren syndrome, which is a complex neurodevelopmental disorder characterized by cardiovascular defects, cerebral dysplasias and a peculiar cognitive-behavioral profile. EIF4H has two kind of isoforms. The short isoform(~25kDa) is the predominant isoform and is expressed alone in liver and skeletal muscle. This is a rabbit anti-EIF4H polyclonal antibody raised against part of N-terminal chain of human EIF4H, and can recognize two kinds of isoform. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1468 Product name: Recombinant human EIF4H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC010021 Sequence: MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQR Predict reactive species Full Name: eukaryotic translation initiation factor 4H Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC010021 Gene Symbol: EIF4H Gene ID (NCBI): 7458 RRID: AB_2096035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15056 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924